PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AS_5B8CF4BA2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 39aa    MW: 4670.37 Da    PI: 10.0135
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AS_5B8CF4BA2.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1287.1e-09138542
                   FAR1  5 eYAkevGFsvrkskskkskrngeitkrtfvCskegkre 42
                           +YA e GFsvrks+ +    n+ i+ r+ vCs++g+re
  Traes_2AS_5B8CF4BA2.1  1 KYALEKGFSVRKSYVEWDGSNKYIILRKIVCSRQGFRE 38
                           6***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.1E-6138IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 39 aa     Download sequence    Send to blast
KYALEKGFSV RKSYVEWDGS NKYIILRKIV CSRQGFRED
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-58HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW5A4F82e-21W5A4F8_WHEAT; Uncharacterized protein
TrEMBLW5G9J92e-21W5G9J9_WHEAT; Uncharacterized protein
TrEMBLW5H8212e-21W5H821_WHEAT; Uncharacterized protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]